PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G275500.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 313aa    MW: 34239.1 Da    PI: 5.1012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G275500.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.4e-155198148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT+eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl
  Sobic.002G275500.3.p 51 RGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 98
                          89******************************99************97 PP

2Myb_DNA-binding47.93.1e-15107148447
                           S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            T  E++  +d++ +lG++ W++Ia++++ gRt++++k++w+++
  Sobic.002G275500.3.p 107 LTDAEEQVVIDLHGKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 148
                           5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-204299IPR009057Homeodomain-like
PROSITE profilePS5129413.0854698IPR017930Myb domain
SuperFamilySSF466892.57E-2648145IPR009057Homeodomain-like
SMARTSM007172.3E-1250100IPR001005SANT/Myb domain
PfamPF002494.1E-145198IPR001005SANT/Myb domain
CDDcd001673.14E-95398No hitNo description
PROSITE profilePS5129426.97799153IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-24100154IPR009057Homeodomain-like
SMARTSM007171.5E-13103151IPR001005SANT/Myb domain
PfamPF002497.8E-13107148IPR001005SANT/Myb domain
CDDcd001673.26E-10108149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MSISNYRSEE GTAGVQAWLV GWLAGYSKSI SNYRWEEGDG RPCCDKLGVK RGPWTAEEDR  60
KLINFILTNG HCCWRAVPKL AGLLRCGKSC RLRWTNYLRP DLKRGLLTDA EEQVVIDLHG  120
KLGNRWSKIA AKLPGRTDNE IKNHWNTHIK KKLIKMGIDP VTHEPLDRKT SSSPATTSQS  180
AKSDEATKQQ SPENDDVVVM RDVPADGCSP TESSTNTVST GGSSSSSSGG HDQDPLVKWL  240
LEEEPPTGDE PWLNFSGSVD VDEFSSIAAG PELLPWDGAT DWLLDYQDFG LGDSATLVDG  300
YMVNNSSNGA KL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27511537108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.87340.0root| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0417710.0BT041771.1 Zea mays full-length cDNA clone ZM_BFb0051B11 mRNA, complete cds.
GenBankBT0624370.0BT062437.1 Zea mays full-length cDNA clone ZM_BFb0298A24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462722.10.0hypothetical protein SORBIDRAFT_02g030900
SwissprotQ50EX62e-95ODO1_PETHY; Protein ODORANT1
TrEMBLC5X6800.0C5X680_SORBI; Putative uncharacterized protein Sb02g030900
STRINGSb02g030900.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-81myb domain protein 42